PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013898289.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family MYB
Protein Properties Length: 724aa    MW: 73150.5 Da    PI: 6.0104
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013898289.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.58.6e-151970148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT....TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg....kgRtlkqcksrwqkyl 48
                     +g WT+eEd + v +v ++G ++Wk+Ia  ++    + R +kqc++rw+++l
   XP_013898289.1 19 KGGWTPEEDAKVVGLVGEHGVRNWKKIADAFNesseNQRNPKQCRERWNNHL 70
                     688*********************************99************97 PP

2Myb_DNA-binding36.41.2e-1176121147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r++WT+eE+  lv+++k +G+  W++Iar+   gR ++ +k+ w++ 
   XP_013898289.1  76 RDPWTEEEERELVEGHKTWGNQ-WSRIARERLPGRAENAIKNLWNTT 121
                      789*****************99.*****98777***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.0791674IPR017930Myb domain
SMARTSM007171.9E-131872IPR001005SANT/Myb domain
SuperFamilySSF466892.58E-2519118IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-232178IPR009057Homeodomain-like
PfamPF139215.9E-182284No hitNo description
CDDcd001679.39E-122270No hitNo description
PROSITE profilePS5129414.94375126IPR017930Myb domain
SMARTSM007171.3E-875124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-1679124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 724 aa     Download sequence    Send to blast
MSSGAALQRT CIHPVAPSKG GWTPEEDAKV VGLVGEHGVR NWKKIADAFN ESSENQRNPK  60
QCRERWNNHL DPNIKRDPWT EEEERELVEG HKTWGNQWSR IARERLPGRA ENAIKNLWNT  120
TRRRNGSVPQ GSGPLEQYMV QLGMREPAAD VEAGSGGSGG DGGPRKRALA QPPPRAASDS  180
GGGGGGGGSS SGGSDGPKKR ARAQPVPHAA SDGGGGGGGG GGLAVELECH EQDPLWPPGF  240
GGAPLAAAVA IRAQAGAGAE VGVLEPSAAG PAHAPRCADR AVVPSHAWAE LFPDETSGSH  300
TSSHSGSRSS SHIDCGGASC PKCRHGIDSS FSTLLGDTCD GAHGLSQQCE RPVFQMETDM  360
AAGLMSWADD ELLGYGPGLS DEDAQLLASL CDPDTAAPDC EPPPPAGAQL ELRPADQPAA  420
AACAARPGGQ PYAAAGWGAA SWDVPARAPA VAGAPGGLVQ QQLRRSAQHS HSFNGSTGLT  480
PLTVPPILCG AANAAAEPPT PGVARDPRQF ISPADHAHAP VGAPVPLFAS GTSPSTMAAA  540
PDAGASRAPP GLTPRWAQLP AVWPPGQEVI VALSEGADPL PPSDAICSAL QAPTAGCPAG  600
AHSAHREVVS STSYGPQAVC GRAAAVAALC GGGSPADPMQ TLGPDAAVGA LAADLQAVLP  660
RLVANAYARA ALSGAVGRVV IGLRLGAAVP PSEPGLVVAV AARSSNEGAA VLKCVVDAIR  720
LLYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31191247106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013898289.10.0Transcription factor MYB98
TrEMBLA0A0D2M7D30.0A0A0D2M7D3_9CHLO; Transcription factor MYB98
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.13e-31myb domain protein 118
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]